Recombinant Human REXO2 Protein, GST-tagged

Cat.No. : REXO2-4033H
Product Overview : Human DKFZP566E144 full-length ORF ( AAH03502, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. [provided by RefSeq, Nov 2011]
Molecular Mass : 34.43 kDa
AA Sequence : MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name REXO2 REX2, RNA exonuclease 2 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol REXO2
Synonyms REXO2; REX2, RNA exonuclease 2 homolog (S. cerevisiae); oligoribonuclease, mitochondrial; CGI 114; DKFZP566E144; SFN; small fragment nuclease; RNA exonuclease 2 homolog; RFN; REX2; CGI-114; MGC111570; DKFZp566E144;
Gene ID 25996
mRNA Refseq NM_015523
Protein Refseq NP_056338
MIM 607149
UniProt ID Q9Y3B8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All REXO2 Products

Required fields are marked with *

My Review for All REXO2 Products

Required fields are marked with *

0
cart-icon
0
compare icon