| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Flag&Myc |
| Protein Length : |
1-79 aa |
| Description : |
ROMO1 (Reactive Oxygen Species Modulator 1) is a mitochondrial inner membrane protein that modulates reactive oxygen species (ROS) levels in cells. It also exhibits antimicrobial activity by inducing bacterial membrane disruption. Also known as C20orf52, MTGM, MTGMP. |
| Form : |
Liquid |
| Molecular Mass : |
8 kDa |
| AASequence : |
MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC |
| Purity : |
> 80% as determined by SDS-PAGE and Coomassie blue staining |
| Notes : |
For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage : |
Store at -80C. Stable for 12 months. Avoid repeated freeze-thaw cycles. |
| Concentration : |
>0.1 ug/uL as determined by microplate BCA method |
| Storage Buffer : |
25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
