Recombinant Full Length Human ROPN1B Protein, C-Flag-tagged
Cat.No. : | ROPN1B-1920HFL |
Product Overview : | Recombinant Full Length Human ROPN1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables protein heterodimerization activity. Predicted to be involved in several processes, including flagellated sperm motility; protein localization to cilium; and sperm capacitation. Located in cytoplasm and motile cilium. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPE LLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKI VCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVW LE myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | ROPN1B rhophilin associated tail protein 1B [ Homo sapiens (human) ] |
Official Symbol | ROPN1B |
Synonyms | AKAP-binding sperm protein ropporin; ropporin, rhophilin associated protein 1B |
Gene ID | 152015 |
mRNA Refseq | NM_001012337.3 |
Protein Refseq | NP_001012337.1 |
UniProt ID | Q9BZX4 |
◆ Recombinant Proteins | ||
ROPN1B-3955R | Recombinant Rhesus monkey ROPN1B Protein, His-tagged | +Inquiry |
ROPN1B-781H | Recombinant Human ROPN1B Protein (1-120 aa), GST-tagged | +Inquiry |
ROPN1B-1920HFL | Recombinant Full Length Human ROPN1B Protein, C-Flag-tagged | +Inquiry |
ROPN1B-3772R | Recombinant Rhesus Macaque ROPN1B Protein, His (Fc)-Avi-tagged | +Inquiry |
ROPN1B-1507H | Recombinant Human ROPN1B Protein (1-120 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROPN1B-1533HCL | Recombinant Human ROPN1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROPN1B Products
Required fields are marked with *
My Review for All ROPN1B Products
Required fields are marked with *
0
Inquiry Basket