Recombinant Full Length Human SGTB Protein, C-Flag-tagged
Cat.No. : | SGTB-2086HFL |
Product Overview : | Recombinant Full Length Human SGTB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable molecular adaptor activity. Predicted to be involved in positive regulation of chaperone-mediated protein folding; posttranslational protein targeting to endoplasmic reticulum membrane; and ubiquitin-dependent ERAD pathway. Predicted to be part of TRC complex. Predicted to be active in membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.2 kDa |
AA Sequence : | MSSIKHLVYAVIRFLREQSQMDTYTSDEQESLEVAIQCLETVFKISPEDTHLAVSQPLTEMFTSSFCKND VLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVSSPTGTG LSFDMASLINNPAFISMAASLMQNPQVQQLMSGMMTNAIGGPAAGVGGLTDLSSLIQAGQQFAQQIQQQN PELIEQLRNHIRSRSFSSSAEEHS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SGTB small glutamine rich tetratricopeptide repeat co-chaperone beta [ Homo sapiens (human) ] |
Official Symbol | SGTB |
Synonyms | SGT2 |
Gene ID | 54557 |
mRNA Refseq | NM_019072.3 |
Protein Refseq | NP_061945.1 |
UniProt ID | Q96EQ0 |
◆ Recombinant Proteins | ||
SGTB-15050M | Recombinant Mouse SGTB Protein | +Inquiry |
SGTB-3068C | Recombinant Chicken SGTB | +Inquiry |
Sgtb-5831M | Recombinant Mouse Sgtb Protein, Myc/DDK-tagged | +Inquiry |
SGTB-2086HFL | Recombinant Full Length Human SGTB Protein, C-Flag-tagged | +Inquiry |
SGTB-5370R | Recombinant Rat SGTB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGTB-1881HCL | Recombinant Human SGTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGTB Products
Required fields are marked with *
My Review for All SGTB Products
Required fields are marked with *
0
Inquiry Basket