Recombinant Full Length Human SLC10A7 Protein, GST-tagged
Cat.No. : | SLC10A7-4744HF |
Product Overview : | Human DKFZP566M114 full-length ORF ( AAH63471, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 159 amino acids |
Description : | SLC10A7 (Solute Carrier Family 10 Member 7) is a Protein Coding gene. GO annotations related to this gene include symporter activity. |
Molecular Mass : | 43.23 kDa |
AA Sequence : | MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHLKLHLFIQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQLLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLC10A7 solute carrier family 10 (sodium/bile acid cotransporter family), member 7 [ Homo sapiens ] |
Official Symbol | SLC10A7 |
Synonyms | SLC10A7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7; C4orf13, chromosome 4 open reading frame 13; sodium/bile acid cotransporter 7; DKFZp313H0531; DKFZp566M114; DKFZp779O2438; MGC25043; SBF-domain containing protein; Na(+)/bile acid cotransporter 7; solute carrier family 10 member 7; P7; C4orf13; |
Gene ID | 84068 |
mRNA Refseq | NM_001029998 |
Protein Refseq | NP_001025169 |
MIM | 611459 |
UniProt ID | Q0GE19 |
◆ Recombinant Proteins | ||
SLC10A7-873Z | Recombinant Zebrafish SLC10A7 | +Inquiry |
SLC10A7-15204M | Recombinant Mouse SLC10A7 Protein | +Inquiry |
SLC10A7-8213M | Recombinant Mouse SLC10A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC10A7-2803C | Recombinant Chicken SLC10A7 | +Inquiry |
SLC10A7-4044H | Recombinant Human SLC10A7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC10A7 Products
Required fields are marked with *
My Review for All SLC10A7 Products
Required fields are marked with *
0
Inquiry Basket