Recombinant Full Length Human SMCP Protein, GST-tagged

Cat.No. : SMCP-6091HF
Product Overview : Human MCSP full-length ORF ( AAH14593, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperms mitochondrial sheath. [provided by RefSeq
Molecular Mass : 38.50 kDa
AA Sequence : MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SMCP sperm mitochondria-associated cysteine-rich protein [ Homo sapiens ]
Official Symbol SMCP
Synonyms SMCP; sperm mitochondria-associated cysteine-rich protein; MCSP, mitochondrial capsule selenoprotein; sperm mitochondrial-associated cysteine-rich protein; mitochondrial capsule selenoprotein; MCS; MCSP; HSMCSGEN1; MGC26305; MGC26519;
Gene ID 4184
mRNA Refseq NM_030663
Protein Refseq NP_109588
MIM 601148
UniProt ID P49901

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMCP Products

Required fields are marked with *

My Review for All SMCP Products

Required fields are marked with *

0
cart-icon
0
compare icon