Recombinant Full Length Human SNRNP48 Protein, GST-tagged
Cat.No. : | SNRNP48-3541HF |
Product Overview : | Human C6orf151 full-length ORF (NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 339 amino acids |
Description : | SNRNP48 (Small Nuclear Ribonucleoprotein U11/U12 Subunit 48) is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SNRNP48 small nuclear ribonucleoprotein 48kDa (U11/U12) [ Homo sapiens ] |
Official Symbol | SNRNP48 |
Synonyms | SNRNP48; small nuclear ribonucleoprotein 48kDa (U11/U12); C6orf151, chromosome 6 open reading frame 151; U11/U12 small nuclear ribonucleoprotein 48 kDa protein; dJ336K20B.1; dJ512B11.2; FLJ32234; U11/U12 snRNP 48K; U11/U12-48K; U11/U12 snRNP 48 kDa protein; C6orf151; MGC138904; MGC138905; |
Gene ID | 154007 |
mRNA Refseq | NM_152551 |
Protein Refseq | NP_689764 |
UniProt ID | Q6IEG0 |
◆ Recombinant Proteins | ||
SNRNP48-1331H | Recombinant Human SNRNP48 Protein, GST-Tagged | +Inquiry |
SNRNP48-4373R | Recombinant Rhesus monkey SNRNP48 Protein, His-tagged | +Inquiry |
SNRNP48-3541HF | Recombinant Full Length Human SNRNP48 Protein, GST-tagged | +Inquiry |
SNRNP48-6552Z | Recombinant Zebrafish SNRNP48 | +Inquiry |
SNRNP48-15689M | Recombinant Mouse SNRNP48 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRNP48-1621HCL | Recombinant Human SNRNP48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNRNP48 Products
Required fields are marked with *
My Review for All SNRNP48 Products
Required fields are marked with *
0
Inquiry Basket