Recombinant Human SNRNP48 Protein, GST-Tagged

Cat.No. : SNRNP48-1331H
Product Overview : Human C6orf151 full-length ORF (NP_689764.3, 1 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SNRNP48 (Small Nuclear Ribonucleoprotein U11/U12 Subunit 48) is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway.
Molecular Mass : 66.4 kDa
AA Sequence : MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTASLGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKIPSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSSLPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVINVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDSRQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKNCESRRRKERDGERHHSHKRRKQKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SNRNP48 small nuclear ribonucleoprotein 48kDa (U11/U12) [ Homo sapiens ]
Official Symbol SNRNP48
Synonyms SNRNP48; small nuclear ribonucleoprotein 48kDa (U11/U12); C6orf151, chromosome 6 open reading frame 151; U11/U12 small nuclear ribonucleoprotein 48 kDa protein; dJ336K20B.1; dJ512B11.2; FLJ32234; U11/U12 snRNP 48K; U11/U12-48K; U11/U12 snRNP 48 kDa protein; C6orf151; MGC138904; MGC138905;
Gene ID 154007
mRNA Refseq NM_152551
Protein Refseq NP_689764
UniProt ID Q6IEG0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRNP48 Products

Required fields are marked with *

My Review for All SNRNP48 Products

Required fields are marked with *

0
cart-icon