Recombinant Full Length Human SNTG1 Protein, C-Flag-tagged
Cat.No. : | SNTG1-1118HFL |
Product Overview : | Recombinant Full Length Human SNTG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal domain that mediates dystrophin binding. This family member plays a role in mediating gamma-enolase trafficking to the plasma membrane and in enhancing its neurotrophic activity. Mutations in this gene are associated with idiopathic scoliosis. Alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.8 kDa |
AA Sequence : | MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGL SIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLK RAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIP LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPV NQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDL LDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACL DPLFLGNQATASTAASSATTSKAKYTTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SNTG1 syntrophin gamma 1 [ Homo sapiens (human) ] |
Official Symbol | SNTG1 |
Synonyms | SYN4; G1SYN |
Gene ID | 54212 |
mRNA Refseq | NM_018967.5 |
Protein Refseq | NP_061840.1 |
MIM | 608714 |
UniProt ID | Q9NSN8 |
◆ Recombinant Proteins | ||
SNTG1-4840H | Recombinant Human SNTG1 protein, His&Myc-tagged | +Inquiry |
SNTG1-2063H | Recombinant Human SNTG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNTG1-2854H | Recombinant Human SNTG1, GST-tagged | +Inquiry |
SNTG1-2198H | Recombinant Human SNTG1 Protein (1-517 aa), His-Myc-tagged | +Inquiry |
Sntg1-6014M | Recombinant Mouse Sntg1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNTG1-1607HCL | Recombinant Human SNTG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNTG1 Products
Required fields are marked with *
My Review for All SNTG1 Products
Required fields are marked with *
0
Inquiry Basket