Recombinant Full Length Human Transmembrane Protein 50B(Tmem50B) Protein, His-Tagged
| Cat.No. : | RFL16586HF |
| Product Overview : | Recombinant Full Length Human Transmembrane protein 50B(TMEM50B) Protein (P56557) (1-158aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-158) |
| Form : | Lyophilized powder |
| AA Sequence : | MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | TMEM50B |
| Synonyms | TMEM50B; C21orf4; UNQ167/PRO193; Transmembrane protein 50B; HCV p7-trans-regulated protein 3 |
| UniProt ID | P56557 |
| ◆ Recombinant Proteins | ||
| RFL16586HF | Recombinant Full Length Human Transmembrane Protein 50B(Tmem50B) Protein, His-Tagged | +Inquiry |
| TMEM50B-4644R | Recombinant Rhesus Macaque TMEM50B Protein, His (Fc)-Avi-tagged | +Inquiry |
| TMEM50B-1031C | Recombinant Cynomolgus TMEM50B Protein, His-tagged | +Inquiry |
| TMEM50B-17053M | Recombinant Mouse TMEM50B Protein | +Inquiry |
| TMEM50B-4830R | Recombinant Rhesus monkey TMEM50B Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TMEM50B-945HCL | Recombinant Human TMEM50B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM50B Products
Required fields are marked with *
My Review for All TMEM50B Products
Required fields are marked with *
