Recombinant Full Length Human UBALD2 Protein, GST-tagged

Cat.No. : UBALD2-4448HF
Product Overview : Human FAM100B full-length ORF ( ABW03765.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 164 amino acids
Description : UBALD2 (UBA Like Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBALD1.
Molecular Mass : 44.44 kDa
AA Sequence : MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBALD2 UBA like domain containing 2 [ Homo sapiens (human) ]
Official Symbol UBALD2
Synonyms UBALD2; UBA like domain containing 2; FAM100B family with sequence similarity 100, member B; UBA Like Domain Containing 2; Family With Sequence Similarity 100, Member B; FAM100B; UBA-Like Domain-Containing Protein 2; UBA-Like Domain Containing 2; Protein FAM100B
Gene ID 283991
mRNA Refseq NM_182565
Protein Refseq NP_872371
UniProt ID Q8IYN6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBALD2 Products

Required fields are marked with *

My Review for All UBALD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon