Recombinant Full Length Human UBALD2 Protein, GST-tagged
Cat.No. : | UBALD2-4448HF |
Product Overview : | Human FAM100B full-length ORF ( ABW03765.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 164 amino acids |
Description : | UBALD2 (UBA Like Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is UBALD1. |
Molecular Mass : | 44.44 kDa |
AA Sequence : | MSVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UBALD2 UBA like domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | UBALD2 |
Synonyms | UBALD2; UBA like domain containing 2; FAM100B family with sequence similarity 100, member B; UBA Like Domain Containing 2; Family With Sequence Similarity 100, Member B; FAM100B; UBA-Like Domain-Containing Protein 2; UBA-Like Domain Containing 2; Protein FAM100B |
Gene ID | 283991 |
mRNA Refseq | NM_182565 |
Protein Refseq | NP_872371 |
UniProt ID | Q8IYN6 |
◆ Recombinant Proteins | ||
UBALD2-6432H | Recombinant Human UBALD2 protein, His&Myc-tagged | +Inquiry |
UBALD2-2908Z | Recombinant Zebrafish UBALD2 | +Inquiry |
UBALD2-3660H | Recombinant Human UBALD2 Protein, GST-tagged | +Inquiry |
UBALD2-4448HF | Recombinant Full Length Human UBALD2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBALD2 Products
Required fields are marked with *
My Review for All UBALD2 Products
Required fields are marked with *