Recombinant Full Length Human UCN3 Protein, GST-tagged
Cat.No. : | UCN3-6867HF |
Product Overview : | Human UCN3 full-length ORF ( NP_444277.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 161 amino acids |
Description : | This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells. This hormone is an endogenous ligand for corticotropin-releasing factor receptor 2 and may regulate insulin secretion in response to plasma glucose levels. Patients with type 2 diabetes exhibit reduced levels of the encoded protein in beta cells. In the brain, the encoded protein may be responsible for the effects of stress on appetite. |
Molecular Mass : | 44.4 kDa |
AA Sequence : | MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK |
Applications : | ELISA WB (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UCN3 urocortin 3 [ Homo sapiens (human) ] |
Official Symbol | UCN3 |
Synonyms | UCN3; urocortin 3; SCP; SPC; UCNIII; urocortin-3; prepro-urocortin 3; stresscopin; ucn III; urocortin III |
Gene ID | 114131 |
mRNA Refseq | NM_053049 |
Protein Refseq | NP_444277 |
MIM | 605901 |
UniProt ID | Q969E3 |
◆ Recombinant Proteins | ||
UCN3-31677TH | Recombinant Human UCN3, His-tagged | +Inquiry |
UCN3-02H | Recombinant Human UCN3 Protein, His-tagged | +Inquiry |
UCN3-3578H | Recombinant Human UCN3, His-tagged | +Inquiry |
Ucn3-7891M | Recombinant Mouse Ucn3 protein, His-tagged | +Inquiry |
UCN3-01H | Recombinant Human UCN3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCN3-527HCL | Recombinant Human UCN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCN3 Products
Required fields are marked with *
My Review for All UCN3 Products
Required fields are marked with *