Recombinant Full Length Human UCN3 Protein, GST-tagged

Cat.No. : UCN3-6867HF
Product Overview : Human UCN3 full-length ORF ( NP_444277.2, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 161 amino acids
Description : This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells. This hormone is an endogenous ligand for corticotropin-releasing factor receptor 2 and may regulate insulin secretion in response to plasma glucose levels. Patients with type 2 diabetes exhibit reduced levels of the encoded protein in beta cells. In the brain, the encoded protein may be responsible for the effects of stress on appetite.
Molecular Mass : 44.4 kDa
AA Sequence : MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
Applications : ELISA
WB (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UCN3 urocortin 3 [ Homo sapiens (human) ]
Official Symbol UCN3
Synonyms UCN3; urocortin 3; SCP; SPC; UCNIII; urocortin-3; prepro-urocortin 3; stresscopin; ucn III; urocortin III
Gene ID 114131
mRNA Refseq NM_053049
Protein Refseq NP_444277
MIM 605901
UniProt ID Q969E3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCN3 Products

Required fields are marked with *

My Review for All UCN3 Products

Required fields are marked with *

0
cart-icon