Recombinant Human UCN3 protein, His-KSI-tagged
Cat.No. : | UCN3-532H |
Product Overview : | Recombinant Human UCN3 protein(Q969E3)(119-161aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 119-161aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK |
Gene Name | UCN3 urocortin 3 (stresscopin) [ Homo sapiens ] |
Official Symbol | UCN3 |
Synonyms | UCN3; urocortin 3 (stresscopin); urocortin-3; SPC; UCNIII; ucn III; stresscopin; urocortin III; SCP; MGC119002; |
Gene ID | 114131 |
mRNA Refseq | NM_053049 |
Protein Refseq | NP_444277 |
MIM | 605901 |
UniProt ID | Q969E3 |
◆ Recombinant Proteins | ||
UCN3-31677TH | Recombinant Human UCN3, His-tagged | +Inquiry |
Ucn3-7891M | Recombinant Mouse Ucn3 protein, His-tagged | +Inquiry |
UCN3-02H | Recombinant Human UCN3 Protein, His-tagged | +Inquiry |
UCN3-01H | Recombinant Human UCN3 Protein, GST-tagged | +Inquiry |
UCN3-3578H | Recombinant Human UCN3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCN3-527HCL | Recombinant Human UCN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCN3 Products
Required fields are marked with *
My Review for All UCN3 Products
Required fields are marked with *