Recombinant Full Length Human Uncharacterized Protein C3Orf71(C3Orf71) Protein, His-Tagged
Cat.No. : | RFL18040HF |
Product Overview : | Recombinant Full Length Human Uncharacterized protein C3orf71(C3orf71) Protein (Q8N7S6) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MLGQRAGDGERPGLPGDGEGGVPARPGRRAERPPQRPAKVNKAVTCAAHLPGAAASRPLS PNKPDRVRPGQRDRIGAKRQRRRRADAGQARAASSRRVVPTAPEVLGAVASLPDRGRPTV ARVATGSRLEGLFSAASLKLSALTQSLTRVRQAPTASGATIRLPASPVEMFLTSAFLTGF SFHCLYSGIGHGEDILASVEQITIVSRPLSGQRGAGPGNSAYTPRRSQGGPRAATTPGFR FPCRGLVRRAVLRLTVTVQDCILTALLAVSFHSIGVVIMTSSYLLGPVVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARIH2OS |
Synonyms | ARIH2OS; C3orf71; Uncharacterized protein ARIH2OS; Ariadne-2 homolog opposite strand protein |
UniProt ID | Q8N7S6 |
◆ Recombinant Proteins | ||
ARIH2OS-1374H | Recombinant Human ARIH2OS | +Inquiry |
ARIH2OS-3929HF | Recombinant Full Length Human ARIH2OS Protein, GST-tagged | +Inquiry |
ARIH2OS-2500H | Recombinant Human ARIH2OS Protein, His (Fc)-Avi-tagged | +Inquiry |
ARIH2OS-5265H | Recombinant Human ARIH2OS Protein, GST-tagged | +Inquiry |
RFL18040HF | Recombinant Full Length Human Uncharacterized Protein C3Orf71(C3Orf71) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARIH2OS Products
Required fields are marked with *
My Review for All ARIH2OS Products
Required fields are marked with *
0
Inquiry Basket