Recombinant Full Length Human VAT1L Protein, C-Flag-tagged
Cat.No. : | VAT1L-1238HFL |
Product Overview : | Recombinant Full Length Human VAT1L Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable oxidoreductase activity and zinc ion binding activity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.7 kDa |
AA Sequence : | MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLFRKAMPEPQDGE LKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVC TPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANLREGMSVLVHSAGGGVGQAVAQLCSTVPNVTVF GTASTFKHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNM VTGETKSFFSFAKSWWQVEKVNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKIKPV VDSLWALEEVKEAMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGEEEEDHEGDSENKERMPFIQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | VAT1L vesicle amine transport 1 like [ Homo sapiens (human) ] |
Official Symbol | VAT1L |
Synonyms | KIAA1576 |
Gene ID | 57687 |
mRNA Refseq | NM_020927.3 |
Protein Refseq | NP_065978.1 |
UniProt ID | Q9HCJ6 |
◆ Recombinant Proteins | ||
Vat1l-6903M | Recombinant Mouse Vat1l Protein, Myc/DDK-tagged | +Inquiry |
VAT1L-17988M | Recombinant Mouse VAT1L Protein | +Inquiry |
VAT1L-2333H | Recombinant Human VAT1L Protein, His (Fc)-Avi-tagged | +Inquiry |
VAT1L-26701TH | Recombinant Human VAT1L, His-tagged | +Inquiry |
VAT1L-10000M | Recombinant Mouse VAT1L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAT1L-424HCL | Recombinant Human VAT1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAT1L Products
Required fields are marked with *
My Review for All VAT1L Products
Required fields are marked with *
0
Inquiry Basket