Recombinant Full Length Human VWC2L Protein, C-Flag-tagged
Cat.No. : | VWC2L-1837HFL |
Product Overview : | Recombinant Full Length Human VWC2L Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be involved in negative regulation of BMP signaling pathway. Predicted to act upstream of or within positive regulation of neuron differentiation. Predicted to be located in extracellular region and synapse. Predicted to be part of AMPA glutamate receptor complex. Predicted to be active in extracellular space. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPG HSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCE PSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQ CSKRECQGKQTV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | VWC2L von Willebrand factor C domain containing 2 like [ Homo sapiens (human) ] |
Official Symbol | VWC2L |
Gene ID | 402117 |
mRNA Refseq | NM_001080500.4 |
Protein Refseq | NP_001073969.1 |
MIM | 619794 |
UniProt ID | B2RUY7 |
◆ Recombinant Proteins | ||
vwc2l-5750Z | Recombinant Zebrafish vwc2l protein, His-tagged | +Inquiry |
VWC2L-1817H | Recombinant Human VWC2L | +Inquiry |
VWC2L-1527H | Recombinant Human VWC2L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VWC2L-2465Z | Recombinant Zebrafish VWC2L Protein (22-223 aa), His-Myc-tagged | +Inquiry |
Vwc2l-6960M | Recombinant Mouse Vwc2l Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VWC2L Products
Required fields are marked with *
My Review for All VWC2L Products
Required fields are marked with *
0
Inquiry Basket