Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 1(Slc16A1) Protein, His-Tagged
Cat.No. : | RFL15926MF |
Product Overview : | Recombinant Full Length Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1) Protein (O35439) (1-76aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meriones unguiculatus (Mongolian jird) (Mongolian gerbil) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-76) |
Form : | Lyophilized powder |
AA Sequence : | LSILAFVDMVARPSMGLAANTKWIRPRIQYFFAASVVANGVCHLLAPLSTSYIGFCVYAG VFGFAFGWLSSVLFET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC16A1 |
Synonyms | SLC16A1; MCT1; Monocarboxylate transporter 1; MCT 1; Solute carrier family 16 member 1; Fragment |
UniProt ID | O35439 |
◆ Recombinant Proteins | ||
SLC16A1-10438Z | Recombinant Zebrafish SLC16A1 | +Inquiry |
SLC16A1-5437R | Recombinant Rat SLC16A1 Protein | +Inquiry |
SLC16A1-4223R | Recombinant Rhesus monkey SLC16A1 Protein, His-tagged | +Inquiry |
SLC16A1-6558H | Recombinant Human SLC16A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLC16A1-953HFL | Recombinant Full Length Human SLC16A1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC16A1 Products
Required fields are marked with *
My Review for All SLC16A1 Products
Required fields are marked with *
0
Inquiry Basket