Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 1(Slc16A1) Protein, His-Tagged
| Cat.No. : | RFL15926MF | 
| Product Overview : | Recombinant Full Length Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1) Protein (O35439) (1-76aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Meriones unguiculatus (Mongolian jird) (Mongolian gerbil) | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-76) | 
| Form : | Lyophilized powder | 
| AA Sequence : | LSILAFVDMVARPSMGLAANTKWIRPRIQYFFAASVVANGVCHLLAPLSTSYIGFCVYAG VFGFAFGWLSSVLFET | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Applications : | SDS-PAGE | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | SLC16A1 | 
| Synonyms | SLC16A1; MCT1; Monocarboxylate transporter 1; MCT 1; Solute carrier family 16 member 1; Fragment | 
| UniProt ID | O35439 | 
| ◆ Recombinant Proteins | ||
| SLC16A1-15227M | Recombinant Mouse SLC16A1 Protein | +Inquiry | 
| SLC16A1-1468C | Recombinant Chicken SLC16A1 | +Inquiry | 
| SLC16A1-6558H | Recombinant Human SLC16A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| RFL15926MF | Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 1(Slc16A1) Protein, His-Tagged | +Inquiry | 
| SLC16A1-6309H | Recombinant Human SLC16A1 Protein (Asn444-Val500), N-His tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All SLC16A1 Products
Required fields are marked with *
My Review for All SLC16A1 Products
Required fields are marked with *
  
        
    
      
            