Recombinant Full Length Mouse Coiled-Coil Domain-Containing Protein 90B, Mitochondrial(Ccdc90B) Protein, His-Tagged
| Cat.No. : | RFL12463MF |
| Product Overview : | Recombinant Full Length Mouse Coiled-coil domain-containing protein 90B, mitochondrial(Ccdc90b) Protein (Q8C3X2) (43-256aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (43-256) |
| Form : | Lyophilized powder |
| AA Sequence : | DYDRRPVDITPLEQRKLTFDTHALVQDLETHGFDKTQAQTIVSVLSTLSNVSLDTIYKEM VTKAQQEITVQQLMAHLDSIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLTNETSRI RADNKLDINLERSRVTDMFTDQEKQLIEATNEFAKKDTQTKSIISETSNKIDTEIASLKT LMESSKLETIRYLAASVFTCLAIALGFYRFWKEN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ccdc90b |
| Synonyms | Ccdc90b; Coiled-coil domain-containing protein 90B, mitochondrial |
| UniProt ID | Q8C3X2 |
| ◆ Recombinant Proteins | ||
| CCDC90B-2946M | Recombinant Mouse CCDC90B Protein | +Inquiry |
| CCDC90B-7609H | Recombinant Human CCDC90B, His-tagged | +Inquiry |
| CCDC90B-2866H | Recombinant Human CCDC90B Protein, MYC/DDK-tagged | +Inquiry |
| CCDC90B-2907HF | Recombinant Full Length Human CCDC90B Protein, GST-tagged | +Inquiry |
| CCDC90B-502R | Recombinant Rhesus Macaque CCDC90B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC90B-163HCL | Recombinant Human CCDC90B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccdc90b Products
Required fields are marked with *
My Review for All Ccdc90b Products
Required fields are marked with *
