Recombinant Full Length Mouse Neuronal Membrane Glycoprotein M6-A(Gpm6A) Protein, His-Tagged
Cat.No. : | RFL23064MF |
Product Overview : | Recombinant Full Length Mouse Neuronal membrane glycoprotein M6-a(Gpm6a) Protein (P35802) (1-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-278) |
Form : | Lyophilized powder |
AA Sequence : | MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpm6a |
Synonyms | Gpm6a; M6a; Neuronal membrane glycoprotein M6-a; M6a |
UniProt ID | P35802 |
◆ Recombinant Proteins | ||
GPM6A-5898H | Recombinant Human GPM6A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPM6A-1951C | Recombinant Chicken GPM6A | +Inquiry |
RFL35627PF | Recombinant Full Length Pongo Abelii Neuronal Membrane Glycoprotein M6-A(Gpm6A) Protein, His-Tagged | +Inquiry |
Gpm6a-3289M | Recombinant Mouse Gpm6a Protein, Myc/DDK-tagged | +Inquiry |
GPM6A-2641R | Recombinant Rat GPM6A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPM6A-5804HCL | Recombinant Human GPM6A 293 Cell Lysate | +Inquiry |
GPM6A-5803HCL | Recombinant Human GPM6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gpm6a Products
Required fields are marked with *
My Review for All Gpm6a Products
Required fields are marked with *