Recombinant Full Length Mouse Outcome Predictor In Acute Leukemia 1 Homolog(Opal1) Protein, His-Tagged
| Cat.No. : | RFL9565MF |
| Product Overview : | Recombinant Full Length Mouse Outcome predictor in acute leukemia 1 homolog(Opal1) Protein (Q8BGW2) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-348) |
| Form : | Lyophilized powder |
| AA Sequence : | MPFLWGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTVVIILSCCCV CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNSLLPPYEEVVNRPPTPPP PYSAFQLQQQQQLLPPPPQGGPPGGSPPGADPPPQGSQGAQSSPLSGPSRSSTRPPSVAD PQSPEVPTDREATKASGTESGSPMAGHGELDPGAFLDQDSECKEELLKDSRSERGGVSPD SEDKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPVD EEEGLCLSSEGQAREHGHPHLPRPPACLLLNTINEQDSPNSQHSGSPS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Wbp1l |
| Synonyms | Wbp1l; D19Wsu162e; Opal1; WW domain binding protein 1-like; Outcome predictor in acute leukemia 1 homolog |
| UniProt ID | Q8BGW2 |
| ◆ Recombinant Proteins | ||
| WBP1L-5000R | Recombinant Rhesus Macaque WBP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| WBP1L-1656HF | Recombinant Full Length Human WBP1L Protein, GST-tagged | +Inquiry |
| WBP1L-5187R | Recombinant Rhesus monkey WBP1L Protein, His-tagged | +Inquiry |
| RFL9877HF | Recombinant Full Length Human Outcome Predictor In Acute Leukemia 1(Opa1L) Protein, His-Tagged | +Inquiry |
| WBP1L-424H | Recombinant Human WBP1L Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WBP1L-8370HCL | Recombinant Human C10orf26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Wbp1l Products
Required fields are marked with *
My Review for All Wbp1l Products
Required fields are marked with *



