Recombinant Full Length Mouse Peroxisomal Membrane Protein 11C(Pex11G) Protein, His-Tagged
| Cat.No. : | RFL34030MF |
| Product Overview : | Recombinant Full Length Mouse Peroxisomal membrane protein 11C(Pex11g) Protein (Q6P6M5) (1-241aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-241) |
| Form : | Lyophilized powder |
| AA Sequence : | MALLNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCR TVLRLFDDLAMFVYTKQYGLGTKEEDIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRV DSAWWWTLNTALWTLSLLLGAVKALWTMLKLRQKLRSPTGTSASQLPRSKRRAMEARICS EVLTLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSTCQAVRAGRQAEADS P |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pex11g |
| Synonyms | Pex11g; Pex11c; Peroxisomal membrane protein 11C; Peroxin-11C; Peroxisomal biogenesis factor 11C; Protein PEX11 homolog gamma; PEX11-gamma |
| UniProt ID | Q6P6M5 |
| ◆ Recombinant Proteins | ||
| PEX11C-6645M | Recombinant Mouse PEX11C Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL28410AF | Recombinant Full Length Arabidopsis Thaliana Peroxisomal Membrane Protein 11C(Pex11C) Protein, His-Tagged | +Inquiry |
| PEX11G-1649H | Recombinant Human PEX11G, GST-tagged | +Inquiry |
| PEX11G-1484C | Recombinant Chicken PEX11G | +Inquiry |
| PEX11C-12645M | Recombinant Mouse PEX11C Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PEX11G-3294HCL | Recombinant Human PEX11G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pex11g Products
Required fields are marked with *
My Review for All Pex11g Products
Required fields are marked with *



