Recombinant Full Length Mouse Prostaglandin E2 Receptor Ep2 Subtype(Ptger2) Protein, His-Tagged
| Cat.No. : | RFL17223MF |
| Product Overview : | Recombinant Full Length Mouse Prostaglandin E2 receptor EP2 subtype(Ptger2) Protein (Q62053) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-362) |
| Form : | Lyophilized powder |
| AA Sequence : | MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAG SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFF SLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYV QYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGS SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRA LRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCG QL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ptger2 |
| Synonyms | Ptger2; Ptgerep2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor |
| UniProt ID | Q62053 |
| ◆ Recombinant Proteins | ||
| PTGER2-3689R | Recombinant Rhesus monkey PTGER2 Protein, His-tagged | +Inquiry |
| PTGER2-4466R | Recombinant Rat PTGER2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ptger2-6743M | Recombinant Mouse Ptger2 protein | +Inquiry |
| RFL30665CF | Recombinant Full Length Dog Prostaglandin E2 Receptor Ep2 Subtype(Ptger2) Protein, His-Tagged | +Inquiry |
| RFL4463RF | Recombinant Full Length Rat Prostaglandin E2 Receptor Ep2 Subtype(Ptger2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTGER2-2718HCL | Recombinant Human PTGER2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ptger2 Products
Required fields are marked with *
My Review for All Ptger2 Products
Required fields are marked with *
