Recombinant Full Length Mouse Ring Finger Protein 183(Rnf183) Protein, His-Tagged
Cat.No. : | RFL29401MF |
Product Overview : | Recombinant Full Length Mouse RING finger protein 183(Rnf183) Protein (Q8QZS5) (1-190aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-190) |
Form : | Lyophilized powder |
AA Sequence : | MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCR QPTVLASGQPVTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDL GAEPGSQTGLPQDTAPDTRPVPIPSHYSLRECVRNPHFRIFAYLMAVILSVTLLLIFSIF WTKQFFWGMG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rnf183 |
Synonyms | Rnf183; E3 ubiquitin-protein ligase RNF183 |
UniProt ID | Q8QZS5 |
◆ Recombinant Proteins | ||
RNF183-7668M | Recombinant Mouse RNF183 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF183-14324M | Recombinant Mouse RNF183 Protein | +Inquiry |
RFL6370HF | Recombinant Full Length Human Ring Finger Protein 183(Rnf183) Protein, His-Tagged | +Inquiry |
RNF183-4546Z | Recombinant Zebrafish RNF183 | +Inquiry |
RFL29401MF | Recombinant Full Length Mouse Ring Finger Protein 183(Rnf183) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF183-2286HCL | Recombinant Human RNF183 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rnf183 Products
Required fields are marked with *
My Review for All Rnf183 Products
Required fields are marked with *
0
Inquiry Basket