Recombinant Full Length Mouse Sodium/Potassium-Transporting Atpase Subunit Beta-3(Atp1B3) Protein, His-Tagged
| Cat.No. : | RFL-3810MF |
| Product Overview : | Recombinant Full Length Mouse Sodium/potassium-transporting ATPase subunit beta-3(Atp1b3) Protein (P97370) (1-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-278) |
| Form : | Lyophilized powder |
| AA Sequence : | GSTHPGKALRKAQQKVLTDASVRLAGTALEGNTFYMENAQPQGGSTSSSPVTLQPNVVYI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Atp1b3 |
| Synonyms | Atp1b3; Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase subunit beta-3; ATPB-3; CD antigen CD298 |
| UniProt ID | P97370 |
| ◆ Recombinant Proteins | ||
| ATP1b3-3767H | Recombinant Human ATP1b3, His-tagged, T7 tagged | +Inquiry |
| ATP1B3-01H | Recombinant mouse ATPase, Na+/K+ transporting, beta 3 polypeptide Protein, Fc-tagged | +Inquiry |
| RFL-4382XF | Recombinant Full Length Xenopus Laevis Sodium/Potassium-Transporting Atpase Subunit Beta-3(Atp1B3) Protein, His-Tagged | +Inquiry |
| ATP1B3-1167HF | Recombinant Full Length Human ATP1B3 Protein | +Inquiry |
| ATP1B3-857R | Recombinant Rat ATP1B3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP1B3-061HKCL | Human ATP1B3 Knockdown Cell Lysate | +Inquiry |
| ATP1B3-8610HCL | Recombinant Human ATP1B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Atp1b3 Products
Required fields are marked with *
My Review for All Atp1b3 Products
Required fields are marked with *
