| Species : |
Mus musculus |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
Full Length (1-358) |
| Form : |
Lyophilized powder |
| AA Sequence : |
MATDNDSFPWDQDSILSSDMFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAAL AVCGNLLVMTSILHFRQLHSPANFLVVSLACADFLVGLTVMPFSTVRSVEGCWYFGESYC KLHTCFDVSFCYCSIFHLCFISVDRYIAVSDPLTYPTRFTAFVSGKCITFSWLLSTIYGF SLLYTGANEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVSGKVLRENSSTTNLFPE |
| Purity : |
Greater than 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : |
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : |
Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |