Recombinant Full Length Mouse Transmembrane Protein 41A(Tmem41A) Protein, His-Tagged
Cat.No. : | RFL4421MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 41A(Tmem41a) Protein (Q9D8U2) (18-264aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (18-264) |
Form : | Lyophilized powder |
AA Sequence : | LYLLSTRLPLGPRLAAAGEPEGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCSAY LYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFPD KVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLALSETSDIGH PDRRKDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem41a |
Synonyms | Tmem41a; Transmembrane protein 41A |
UniProt ID | Q9D8U2 |
◆ Recombinant Proteins | ||
TMEM41A-1776H | Recombinant Human TMEM41A | +Inquiry |
RFL10014HF | Recombinant Full Length Human Transmembrane Protein 41A(Tmem41A) Protein, His-Tagged | +Inquiry |
TMEM41A-4213H | Recombinant Human TMEM41A Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM41A-4638R | Recombinant Rhesus Macaque TMEM41A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL16531BF | Recombinant Full Length Bovine Transmembrane Protein 41A(Tmem41A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM41A-952HCL | Recombinant Human TMEM41A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmem41a Products
Required fields are marked with *
My Review for All Tmem41a Products
Required fields are marked with *