Recombinant Full Length Mouse Tumor Suppressor Candidate 3(Tusc3) Protein, His-Tagged
Cat.No. : | RFL22591MF |
Product Overview : | Recombinant Full Length Mouse Tumor suppressor candidate 3(Tusc3) Protein (Q8BTV1) (42-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (42-347) |
Form : | Lyophilized powder |
AA Sequence : | QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSFLIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tusc3 |
Synonyms | Tusc3; N33; Tumor suppressor candidate 3; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; Oligosaccharyl transferase subunit TUSC3; Magnesium uptake/transporter TUSC3; Protein N33 |
UniProt ID | Q8BTV1 |
◆ Recombinant Proteins | ||
TUSC3-4845R | Recombinant Rhesus Macaque TUSC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUSC3-5032R | Recombinant Rhesus monkey TUSC3 Protein, His-tagged | +Inquiry |
TUSC3-17639M | Recombinant Mouse TUSC3 Protein | +Inquiry |
TUSC3-3489H | Recombinant Human TUSC3, GST-tagged | +Inquiry |
RFL22591MF | Recombinant Full Length Mouse Tumor Suppressor Candidate 3(Tusc3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUSC3-635HCL | Recombinant Human TUSC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tusc3 Products
Required fields are marked with *
My Review for All Tusc3 Products
Required fields are marked with *