Recombinant Full Length Mouse Udp-Glucuronosyltransferase 1-9(Ugt1A9) Protein, His-Tagged
Cat.No. : | RFL12645MF |
Product Overview : | Recombinant Full Length Mouse UDP-glucuronosyltransferase 1-9(Ugt1a9) Protein (Q62452) (24-528aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-528) |
Form : | Lyophilized powder |
AA Sequence : | GRLLVVPMDGSHWFTMQMVVEKLIHRGHEVVVVIPEVSWQLGKSLNCTVKTYSISHTLED LDREFKYLSYTQWKTPEHSIRSFLTGSARGFFELTFSHCRSLFNDKKLVEYLKQRFFDAV FLDPFDVCGLIVAKYFSLPSVIFARGVFCDYLEEGAQCPSLPSYVPRLFSKYTDTMTFKE RVWNHLIYIEEHAFCSYFLRTAVEVASEILQTPVTMTDLFSPVSIWLLRTDFVLEFPRPV MPNMVFIGGINCLQKKSLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGR IPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPM VMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHK DRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFK CCAYGCRKCFGGKGRVKKSHKSKTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ugt1a9 |
Synonyms | Ugt1a9; Ugt1; Ugt1a12; UDP-glucuronosyltransferase 1A9; UGT1A9; UDP-glucuronosyltransferase 1-7; UDPGT; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UGT1A12; UGTP4 |
UniProt ID | Q62452 |
◆ Recombinant Proteins | ||
UGT1A9-541HF | Recombinant Full Length Human UGT1A9 Protein, GST-tagged | +Inquiry |
UGT1A9-3587H | Recombinant Human UGT1A9, GST-tagged | +Inquiry |
RFL12645MF | Recombinant Full Length Mouse Udp-Glucuronosyltransferase 1-9(Ugt1A9) Protein, His-Tagged | +Inquiry |
UGT1A9-821C | Recombinant Cynomolgus Monkey UGT1A9 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGT1A9-01H | Recombinant Human UGT1A9 Protein, 6×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UGT1A9-510HCL | Recombinant Human UGT1A9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ugt1a9 Products
Required fields are marked with *
My Review for All Ugt1a9 Products
Required fields are marked with *
0
Inquiry Basket