Recombinant Full Length Pig Kynurenine 3-Monooxygenase(Kmo) Protein, His-Tagged
Cat.No. : | RFL17348SF |
Product Overview : | Recombinant Full Length Pig Kynurenine 3-monooxygenase(KMO) Protein (Q9MZS9) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MDSSDIQRTSIAVIGGGLVGSLNACFLAKRNFQVDVYESREDIRMAEFARGRSINLALSY RGRQALKAIGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSISRENLNKDLLT AVEKYPNAKVHFGHQLLKCRPETGVITLLGPDKVPKDIACDLILGCDGAYSTVRTHLVKK PRFDYSQQYIPHGYMELTIPPQNGDFAMEPNYLHIWPRDTFMMIALPNMNKSFTCTLFMP FEEFEKLLTSRDVLDFFQKYFPDSLHLIGKEALAQDFFRLPAQPMISVKCSSFHFNSHCV LMGDAAHALVPFFGQGMNAGFEDCLVFDELMDKFNNDFSMCLPEFSKFRIPDDHAISDLS MYNYIEMRSHVNSRWFIFQKNIERCLHTLMPSTFIPLYTMVTFSRIRYHEAMLRWQWQKK VINTALFFFGTLVALSTTYLLTGPTFRSSLGCLRRSWNSVTYFQNIGRISL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KMO |
Synonyms | KMO; Kynurenine 3-monooxygenase; Fpk; Kynurenine 3-hydroxylase |
UniProt ID | Q9MZS9 |
◆ Recombinant Proteins | ||
RFL8968MF | Recombinant Full Length Mouse Kynurenine 3-Monooxygenase(Kmo) Protein, His-Tagged | +Inquiry |
KMO-3301R | Recombinant Rat KMO Protein | +Inquiry |
KMO-3141H | Recombinant Human KMO protein, 6xHis-tagged | +Inquiry |
KMO-516H | Recombinant Human KMO Protein, MYC/DDK-tagged | +Inquiry |
KMO-3745Z | Recombinant Zebrafish KMO | +Inquiry |
◆ Cell & Tissue Lysates | ||
KMO-951HCL | Recombinant Human KMO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KMO Products
Required fields are marked with *
My Review for All KMO Products
Required fields are marked with *
0
Inquiry Basket