Recombinant Full Length Pongo Abelii Neuronal Membrane Glycoprotein M6-A(Gpm6A) Protein, His-Tagged
Cat.No. : | RFL35627PF |
Product Overview : | Recombinant Full Length Pongo abelii Neuronal membrane glycoprotein M6-a(GPM6A) Protein (Q5R9Q3) (1-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-278) |
Form : | Lyophilized powder |
AA Sequence : | MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQT YFEMARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKIT TCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQF GIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGAGAAVIAMVHYLMVLSANWA YVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPM6A |
Synonyms | GPM6A; Neuronal membrane glycoprotein M6-a; M6a |
UniProt ID | Q5R9Q3 |
◆ Recombinant Proteins | ||
GPM6A-3527H | Recombinant Human GPM6A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPM6A-1936R | Recombinant Rhesus monkey GPM6A Protein, His-tagged | +Inquiry |
GPM6A-1951C | Recombinant Chicken GPM6A | +Inquiry |
GPM6A-304C | Recombinant Cynomolgus Monkey GPM6A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27776BF | Recombinant Full Length Bovine Neuronal Membrane Glycoprotein M6-A(Gpm6A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPM6A-5804HCL | Recombinant Human GPM6A 293 Cell Lysate | +Inquiry |
GPM6A-5803HCL | Recombinant Human GPM6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPM6A Products
Required fields are marked with *
My Review for All GPM6A Products
Required fields are marked with *
0
Inquiry Basket