Recombinant Full Length Rat Ankyrin Repeat Domain-Containing Protein 46(Ankrd46) Protein, His-Tagged
| Cat.No. : | RFL12793RF |
| Product Overview : | Recombinant Full Length Rat Ankyrin repeat domain-containing protein 46(Ankrd46) Protein (Q76K24) (1-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-228) |
| Form : | Lyophilized powder |
| AA Sequence : | MSYVFVNDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADPLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPGLVH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ankrd46 |
| Synonyms | Ankrd46; Ankyrin repeat domain-containing protein 46; Ankyrin repeat small protein; ANK-S |
| UniProt ID | Q76K24 |
| ◆ Recombinant Proteins | ||
| RFL15972HF | Recombinant Full Length Human Ankyrin Repeat Domain-Containing Protein 46(Ankrd46) Protein, His-Tagged | +Inquiry |
| ANKRD46-1678M | Recombinant Mouse ANKRD46 Protein | +Inquiry |
| ANKRD46-159R | Recombinant Rhesus Macaque ANKRD46 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANKRD46-331R | Recombinant Rhesus monkey ANKRD46 Protein, His-tagged | +Inquiry |
| ANKRD46-301490H | Recombinant Human ANKRD46 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ankrd46 Products
Required fields are marked with *
My Review for All Ankrd46 Products
Required fields are marked with *
