Recombinant Full Length Rat Cmp-N-Acetylneuraminate-Beta-Galactosamide-Alpha-2,3-Sialyltransferase 4(St3Gal4) Protein, His-Tagged
| Cat.No. : | RFL6227RF |
| Product Overview : | Recombinant Full Length Rat CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4(St3gal4) Protein (P61131) (1-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-333) |
| Form : | Lyophilized powder |
| AA Sequence : | MTSKSHWKLLALALVLVVVMVWYSISREDRYIEFFYFPVSEKKEPCFQGEAERQASKIFGNHSREQPIFLQLKDYFWVKTPSAYELPFGTKGSEDLLLRVLAITSYSIPESIQSLECRRCVVVGNGHRLKNSSLGGVINKYDVVIRLNNAPVAGYEGDVGSKTTIRLFYPESAHFDPKIENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPIQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEAVAIKRMLEMGAVKNLTYF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | St3gal4 |
| Synonyms | St3gal4; Siat4c; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; Alpha 2,3-ST 4; Beta-galactoside alpha-2,3-sialyltransferase 4; Alpha 2,3-sialyltransferase IV; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; Gal-beta-1,4-GlcNAc |
| UniProt ID | P61131 |
| ◆ Recombinant Proteins | ||
| ST3GAL4-5349Z | Recombinant Zebrafish ST3GAL4 | +Inquiry |
| ST3GAL4-5428R | Recombinant Rat ST3GAL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ST3GAL4-8761M | Recombinant Mouse ST3GAL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ST3GAL4-13H | Active Recombinant Human ST3GAL4 Protein (AA 34-329), N-6×His/GFP tagged | +Inquiry |
| ST3GAL4-1141Z | Recombinant Zebrafish ST3GAL4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST3GAL4-633HCL | Recombinant Human ST3GAL4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All St3gal4 Products
Required fields are marked with *
My Review for All St3gal4 Products
Required fields are marked with *
