Recombinant Full Length Rat Elongation Of Very Long Chain Fatty Acids Protein 6(Elovl6) Protein, His-Tagged
| Cat.No. : | RFL5562RF |
| Product Overview : | Recombinant Full Length Rat Elongation of very long chain fatty acids protein 6(Elovl6) Protein (Q920L6) (1-267aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-267) |
| Form : | Lyophilized powder |
| AA Sequence : | MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLM YLSYLLLFCHFFFEAYIGKVKKATKAE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Elovl6 |
| Synonyms | Elovl6; Face; Lce; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase Elovl6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Fatty acid elongase 2; rELO2; Fatty acyl-CoA elongase; Long-chain fatty-acyl elongase; Very long cha |
| UniProt ID | Q920L6 |
| ◆ Recombinant Proteins | ||
| ELOVL6-1454R | Recombinant Rhesus monkey ELOVL6 Protein, His-tagged | +Inquiry |
| ELOVL6-2754M | Recombinant Mouse ELOVL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELOVL6-3183C | Recombinant Chicken ELOVL6 | +Inquiry |
| ELOVL6-1278R | Recombinant Rhesus Macaque ELOVL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL6810GF | Recombinant Full Length Chicken Elongation Of Very Long Chain Fatty Acids Protein 6(Elovl6) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Elovl6 Products
Required fields are marked with *
My Review for All Elovl6 Products
Required fields are marked with *
