Recombinant Full Length Rat Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged
Cat.No. : | RFL27762RF |
Product Overview : | Recombinant Full Length Rat Integral membrane protein 2C(Itm2c) Protein (Q5PQL7) (1-269aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-269) |
Form : | Lyophilized powder |
AA Sequence : | MVKISFQPAVAGVKAEKADKAAASGPASASAPAAEILLTPAREERPPRHRSRKGGSVGGV CYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQIRTRLELEEDV KIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRN FWELLMNVKRGTYLPQTYIIQEEMVVTEHVRDKEALGSFIYHLCNGKDTYRLRRRATRRR INKRGAKNCNAIRHFENTFVVETLICGVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Itm2c |
Synonyms | Itm2c; Integral membrane protein 2C |
UniProt ID | Q5PQL7 |
◆ Recombinant Proteins | ||
ITM2C-8383M | Recombinant Mouse ITM2C Protein | +Inquiry |
ITM2C-633C | Recombinant Cynomolgus ITM2C Protein, His-tagged | +Inquiry |
ITM2C-2777R | Recombinant Rat ITM2C Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29413HF | Recombinant Full Length Human Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged | +Inquiry |
RFL17433MF | Recombinant Full Length Macaca Fascicularis Integral Membrane Protein 2C(Itm2C) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2C-5115HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
ITM2C-5116HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
ITM2C-5114HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Itm2c Products
Required fields are marked with *
My Review for All Itm2c Products
Required fields are marked with *