Recombinant Full Length Rat Lysosome-Associated Membrane Glycoprotein 1(Lamp1) Protein, His-Tagged
| Cat.No. : | RFL4555RF |
| Product Overview : | Recombinant Full Length Rat Lysosome-associated membrane glycoprotein 1(Lamp1) Protein (P14562) (22-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-407) |
| Form : | Lyophilized powder |
| AA Sequence : | APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Lamp1 |
| Synonyms | Lamp1; Lamp-1; Lysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; 120 kDa lysosomal membrane glycoprotein; LGP-120; CD107 antigen-like family member A; CD antigen CD107a |
| UniProt ID | P14562 |
| ◆ Recombinant Proteins | ||
| LAMP1-4414H | Recombinant Human LAMP1 Protein (Met1-Met382), C-His tagged | +Inquiry |
| LAMP1-4415H | Recombinant Human LAMP1 Protein (Ala29-Met382), C-Fc tagged | +Inquiry |
| LAMP1-8940M | Recombinant Mouse LAMP1 Protein | +Inquiry |
| LAMP1-1276H | Recombinant Human LAMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Lamp1-1291M | Recombinant Mouse Lamp1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAMP1-486HKCL | Human LAMP1 Knockdown Cell Lysate | +Inquiry |
| LAMP1-2555HCL | Recombinant Human LAMP1 cell lysate | +Inquiry |
| LAMP1-1486RCL | Recombinant Rat LAMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lamp1 Products
Required fields are marked with *
My Review for All Lamp1 Products
Required fields are marked with *



