Recombinant Full Length Rat Peroxisomal Membrane Protein 11A(Pex11A) Protein, His-Tagged
| Cat.No. : | RFL5364RF |
| Product Overview : | Recombinant Full Length Rat Peroxisomal membrane protein 11A(Pex11a) Protein (O70597) (1-246aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-246) |
| Form : | Lyophilized powder |
| AA Sequence : | MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFR LGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQ MRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFL LLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQ LKLKAR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pex11a |
| Synonyms | Pex11a; Pex11; Peroxisomal membrane protein 11A; 28 kDa peroxisomal integral membrane protein; PMP28; Peroxin-11A; Peroxisomal biogenesis factor 11A; Peroxisomal coatomer receptor; Peroxisomal membrane protein 26; Pmp26p; Protein PEX11 homolog alpha; PEX1 |
| UniProt ID | O70597 |
| ◆ Recombinant Proteins | ||
| PEX11A-5959Z | Recombinant Zebrafish PEX11A | +Inquiry |
| PEX11A-584H | Recombinant Human PEX11A Protein, Fc-tagged | +Inquiry |
| PEX11A-4040R | Recombinant Rat PEX11A Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL34037HF | Recombinant Full Length Human Peroxisomal Membrane Protein 11A(Pex11A) Protein, His-Tagged | +Inquiry |
| PEX11A-6643M | Recombinant Mouse PEX11A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PEX11A-479HCL | Recombinant Human PEX11A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pex11a Products
Required fields are marked with *
My Review for All Pex11a Products
Required fields are marked with *



