Recombinant Full Length Rat Vomeronasal Type-1 Receptor B13(V1Rb13) Protein, His-Tagged
Cat.No. : | RFL9694RF |
Product Overview : | Recombinant Full Length Rat Vomeronasal type-1 receptor B13(V1rb13) Protein (Q5J3M3) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MNKVNILPSDTNMKITLFSELSVGISANSILFFAHLCMFFEENRSKPIDLCIAFLSLTQL MLLVTMGLIAADMFMAQGIWDITTCRSLIYFHRLLRGFNLCAACLLHILWTFTLSPRSSC LTKFKHKSPHHISGAYLFFCVLYMSFSSHLFVLVIATSNLTSDHFMYVTQSCSLLPMSYS RTSTFSLLMVTREVFLISLMALSSGYMVTLLWRHKKQAQHLHSTRLSSKASPQQRATRTI LLLMTFFVVFYILGTVIFHSRTKFKDGSIFYCVQIIVSHSYATISPFVFVFSEKRIIKFF RSMCGRIVNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vom1r101 |
Synonyms | Vom1r101; V1rb13; V1rb7; Vomeronasal type-1 receptor 101; Pheromone receptor VN7; Vomeronasal receptor 7; Vomeronasal type-1 receptor B13 |
UniProt ID | Q5J3M3 |
◆ Recombinant Proteins | ||
VOM1R101-6530R | Recombinant Rat VOM1R101 Protein | +Inquiry |
RFL9694RF | Recombinant Full Length Rat Vomeronasal Type-1 Receptor B13(V1Rb13) Protein, His-Tagged | +Inquiry |
Vmn1r101-6184R | Recombinant Rat Vmn1r101 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vmn1r101 Products
Required fields are marked with *
My Review for All Vmn1r101 Products
Required fields are marked with *
0
Inquiry Basket