Recombinant Full Length Rat Zinc Transporter 1(Slc30A1) Protein, His-Tagged
| Cat.No. : | RFL31581RF |
| Product Overview : | Recombinant Full Length Rat Zinc transporter 1(Slc30a1) Protein (Q62720) (329-507aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (329-507) |
| Form : | Lyophilized powder |
| AA Sequence : | YTTYPLLKESALILLQTVPKQIDIKHLVKELRDVEGVEEVHELHVWQLAGSRIIATAHIK CEDPASYMQVAKTIKDVFHNHGIHATTIQPEFASVGSKSSVVPCELACRTQCALKQCCGT RPQVHSGKEAEKAPTVSISCLELSENLEKKPRRTKAEGSVPAVVIEIKNVPNKQPESSL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Slc30a1 |
| Synonyms | Slc30a1; Znt1; Zinc transporter 1; ZnT-1; Solute carrier family 30 member 1 |
| UniProt ID | Q62720 |
| ◆ Recombinant Proteins | ||
| SLC30A1-5502R | Recombinant Rat SLC30A1 Protein | +Inquiry |
| SLC30A1-674C | Recombinant Cynomolgus Monkey SLC30A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL27766MF | Recombinant Full Length Mouse Zinc Transporter 1(Slc30A1) Protein, His-Tagged | +Inquiry |
| Slc30a1-5924M | Recombinant Mouse Slc30a1 Protein, Myc/DDK-tagged | +Inquiry |
| RFL31581RF | Recombinant Full Length Rat Zinc Transporter 1(Slc30A1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC30A1-603HCL | Recombinant Human SLC30A1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc30a1 Products
Required fields are marked with *
My Review for All Slc30a1 Products
Required fields are marked with *
