Recombinant Full Length Schizosaccharomyces Pombe Mitochondrial Inner Membrane Magnesium Transporter Mrs2(Mrs2) Protein, His-Tagged
Cat.No. : | RFL4544SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Mitochondrial inner membrane magnesium transporter mrs2(mrs2) Protein (P87149) (50-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (50-422) |
Form : | Lyophilized powder |
AA Sequence : | ATDSNPLITGFPETSKNCPPSVAATKNRLLMNCTEFDDHGNVRVISGDFKKMDLCKQNGL LPRDLRKLNTSINSIVPVILVREGSILINLLHIRALIKANSVLLFDVYGSQHSHSQSQFI YELEGRLKQKSSDFGWLPYEMRALETILVSVVNTLDSELHVLHNLVSDLLADFELDINQE RLRTLLIFSKRLSGFLKKATLIRDVLDELLEQDQDLAGMYLTERLKTGKPRDLDKHDEVE LLLETYCKQVDEIVQQTDNLVGNIRSTEEICNIMLDANRNSLMLLGLKLSAMTLGLGFGA VVASLYGMNLQNGLENHPYAFYITTGSIFAFAAFLSSLGILKIRRLKRIQMALYHRCNLP ISLDPRSLRPPYL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mrs2 |
Synonyms | mrs2; SPBC25H2.08c; Mitochondrial inner membrane magnesium transporter mrs2; RNA-splicing protein mrs2 |
UniProt ID | P87149 |
◆ Cell & Tissue Lysates | ||
MRS2-67HCL | Recombinant Full Length Human MRS2 overexpression lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All mrs2 Products
Required fields are marked with *
My Review for All mrs2 Products
Required fields are marked with *
0
Inquiry Basket