Recombinant Full Length Xenopus Laevis Calcitonin Gene-Related Peptide Type 1 Receptor(Calcrl) Protein, His-Tagged
Cat.No. : | RFL1126XF |
Product Overview : | Recombinant Full Length Xenopus laevis Calcitonin gene-related peptide type 1 receptor(calcrl) Protein (Q7ZXS8) (34-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (34-476) |
Form : | Lyophilized powder |
AA Sequence : | SQEQEAKTSVPEERQVGVTQNKIMTAQYECYQKIMQEPAHGKEGQFCNRTWDGWLCWGDV AAGIISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTA LNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAV ANNQALVATNPVICKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLL GWGFPLIPACIHAVARSLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLIT KLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGL LVATIFCFFNGEVQAVLKRHWNQYRIQFGSFAHSEGLRSASYTVSSISEIQGTTYTHDYS EHSNGKNCHDMENVFFKTEKQYM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | calcrl |
Synonyms | calcrl; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor |
UniProt ID | Q7ZXS8 |
◆ Recombinant Proteins | ||
RFL1126XF | Recombinant Full Length Xenopus Laevis Calcitonin Gene-Related Peptide Type 1 Receptor(Calcrl) Protein, His-Tagged | +Inquiry |
CALCRL-0298H | Recombinant Human CALCRL Protein | +Inquiry |
CALCRL-1053HFL | Recombinant Human CALCRL protein, His&Flag-tagged | +Inquiry |
RFL32837HF | Recombinant Full Length Human Calcitonin Gene-Related Peptide Type 1 Receptor(Calcrl) Protein, His-Tagged | +Inquiry |
CALCRL-3992C | Recombinant Chicken CALCRL | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCRL-273HCL | Recombinant Human CALCRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All calcrl Products
Required fields are marked with *
My Review for All calcrl Products
Required fields are marked with *
0
Inquiry Basket