Recombinant Full Length Xenopus Laevis Potassium Voltage-Gated Channel Subfamily Kqt Member 1(Kcnq1) Protein, His-Tagged
| Cat.No. : | RFL27085XF |
| Product Overview : | Recombinant Full Length Xenopus laevis Potassium voltage-gated channel subfamily KQT member 1(kcnq1) Protein (P70057) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Xenopus laevis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-377) |
| Form : | Lyophilized powder |
| AA Sequence : | MNENAINSLYEAIPLPQDGSSNGQRQEDRQANSFELKRETLVATDPPRPTINLDPRVSIY SGRRPLLSRTNIQGRVYNFLERPTGWKCFVYHFTVFLIVLICLIFSVLSTIQQYNNLATE TLFWMEIVLVVFFGAEYVVRLWSAGCRSKYVGVWGRLRFARKPISVIDLIVVVASVIVLC VGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLI FSSYFVYLAEKDAIDSSGEYQFGSYADALWWGVVTVTTIGYGDKVPQTWIGKTIASCFSV FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSATWKI YIRKQSRNHHIMSPSPK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | kcnq1 |
| Synonyms | kcnq1; kvlqt1; Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha xKvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1 |
| UniProt ID | P70057 |
| ◆ Recombinant Proteins | ||
| KCNQ1-2783H | Recombinant Human KCNQ1 protein(391-460 aa), C-His-tagged | +Inquiry |
| KCNQ1-2877R | Recombinant Rat KCNQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KCNQ1-6648Z | Recombinant Zebrafish KCNQ1 | +Inquiry |
| KCNQ1-8546M | Recombinant Mouse KCNQ1 Protein | +Inquiry |
| RFL34329FF | Recombinant Full Length Cat Potassium Voltage-Gated Channel Subfamily Kqt Member 1(Kcnq1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KCNQ1-5020HCL | Recombinant Human KCNQ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All kcnq1 Products
Required fields are marked with *
My Review for All kcnq1 Products
Required fields are marked with *
