Recombinant Full Length Xenopus Laevis Probable G-Protein Coupled Receptor 146(Gpr146) Protein, His-Tagged
Cat.No. : | RFL26444XF |
Product Overview : | Recombinant Full Length Xenopus laevis Probable G-protein coupled receptor 146(gpr146) Protein (Q6P7G9) (1-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-333) |
Form : | Lyophilized powder |
AA Sequence : | MWSCEDLNYTNSGEEQYLCNEFHLFLFIFSVLYLIICFPVGLCYNVQLVLVNLYNKATMT MPDVYFVNMAIAGLIINAVAPVYLFGPAYTKWSLWSFGNEVYITLLILFNVSSLVIMYST TLLSLDYYIECALPRTYMSSVYNTKHVCGFIWGGAVLTSFSSLLFYICNHVSTKIIECSK MQNREAADAIMVLIGYVVPIIAVIYALVLILQIRKEATPLDQESGRLDPSVHRLLIATVC TQFILWTPYYVTLLVNTFMDARVKSSNTFYIRIFQFTEGLSNFLAFSSSFVLPLIHRHIN KNFSGKLQRLLKRLHCGSQGCTHEHTVVQQVMT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpr146 |
Synonyms | gpr146; Probable G-protein coupled receptor 146 |
UniProt ID | Q6P7G9 |
◆ Recombinant Proteins | ||
GPR146-1942R | Recombinant Rhesus monkey GPR146 Protein, His-tagged | +Inquiry |
GPR146-1762R | Recombinant Rhesus Macaque GPR146 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gpr146-1486M | Recombinant Mouse Gpr146 Full Length Transmembrane protein, His-tagged | +Inquiry |
GPR146-5642HF | Recombinant Full Length Human GPR146 Protein | +Inquiry |
GPR146-7149M | Recombinant Mouse GPR146 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR146-5797HCL | Recombinant Human GPR146 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All gpr146 Products
Required fields are marked with *
My Review for All gpr146 Products
Required fields are marked with *
0
Inquiry Basket