Recombinant Full Length Xenopus Laevis Protein Jagunal Homolog 1(Jagn1) Protein, His-Tagged
Cat.No. : | RFL29940XF |
Product Overview : | Recombinant Full Length Xenopus laevis Protein jagunal homolog 1(jagn1) Protein (Q5M7C7) (1-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-183) |
Form : | Lyophilized powder |
AA Sequence : | MASRAGPRATGSDGSDFQHREKVAGHYKMSASLKNEIKKLIYAHLIIWMLIAAQMCVSHL KLVSKDLVAMPYQWEYPYLLSLVPSLFGLFSFPRNNISYLVISMISTGLFSIGPLIYGTL EMFPMAQQLYRHGKAYRFIFGFSAISVMYLVMVVAVQVHGWQIYYSKKLLDSWFTNTQEK KKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | jagn1 |
Synonyms | jagn1; Protein jagunal homolog 1 |
UniProt ID | Q5M7C7 |
◆ Recombinant Proteins | ||
RFL34310HF | Recombinant Full Length Human Protein Jagunal Homolog 1(Jagn1) Protein, His-Tagged | +Inquiry |
JAGN1-3135R | Recombinant Rat JAGN1 Protein | +Inquiry |
JAGN1-2146R | Recombinant Rhesus Macaque JAGN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
JAGN1-2325R | Recombinant Rhesus monkey JAGN1 Protein, His-tagged | +Inquiry |
JAGN1-0453H | Recombinant Human JAGN1 Protein (M1-K183), 10×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAGN1-5108HCL | Recombinant Human JAGN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All jagn1 Products
Required fields are marked with *
My Review for All jagn1 Products
Required fields are marked with *