Recombinant Full Length Xenopus Tropicalis Ubiquitin Carboxyl-Terminal Hydrolase 30(Usp30) Protein, His-Tagged
Cat.No. : | RFL35521XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Ubiquitin carboxyl-terminal hydrolase 30(usp30) Protein (A4QNN3) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MSWAPVSTWSRRTPLAACCSAPELPPAGAWKACAAGSLRIGPQGRCKMMKNWGMIGGIAAALAAGIYVLWGPISDRKKYRKGLVPGLLNLGNTCFMNSLLQGLASCPSFIRWLADFTSKYRQENNTTEHQHLSVTLLHLLKALCNQEGTEDEVLDASPLLEVLRAHRWQISSFEEQDAHELFHVLTSSLEDERDRRPHVTHLFDLDSLEFPLEPQRQIHCRTQVPIYPIPSQWKSQHPFHGRLTSNMVCKHCQHQSPMRYDTFDSLSLSIPVATWGHPITLDQCLQHFISTESVKDVVCENCTKIHAAQIPNSQSVENRKTTFVKQLKLGKLPQCLCIHLQRLSWSNQGSPLKRNEHVQFSEFLAMDRFKYRISGCSTSKQPANHLSAAEQETTDGKEGGAQNPTMPFLNGACSTSYISPPFTSPLPTNPEWTSSSYLFRLMAVVVHHGDMHSGHFVTYRRSPAAKNQKLTSQQWLWISDDTVRRTNFQEVLSSSAYLLFYERIQSNLHHPEDQRAAEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | usp30 |
Synonyms | usp30; TEgg099b09.1; Ubiquitin carboxyl-terminal hydrolase 30; Deubiquitinating enzyme 30; Ubiquitin thioesterase 30; Ubiquitin-specific-processing protease 30; Ub-specific protease 30 |
UniProt ID | A4QNN3 |
◆ Recombinant Proteins | ||
USP30-17920M | Recombinant Mouse USP30 Protein | +Inquiry |
USP30-1252H | Recombinant Human USP30 protein, GST-tagged | +Inquiry |
USP30-12H | Active Recombinant Human USP30 protein, His-tagged | +Inquiry |
USP30-363H | Recombinant Human USP30 Protein, GST-tagged | +Inquiry |
RFL6309DF | Recombinant Full Length Danio Rerio Ubiquitin Carboxyl-Terminal Hydrolase 30(Usp30) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP30-001HCL | Recombinant Human USP30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All usp30 Products
Required fields are marked with *
My Review for All usp30 Products
Required fields are marked with *
0
Inquiry Basket