Recombinant Haemophilus influenzae omp26 Protein

• Cat.No.: omp26-49H
• Product Overview: Recombinant Haemophilus influenzae omp26 Protein was expressed in E. coli.

Specification

• Species: Haemophilus influenzae
• Source: E.coli
• Description: Outer membrane protein 26
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~22 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMEEKIAFINAGYIFQHHPDRQAVADKLDAEFKPVAEKLAASKKEVDDKIAAARKKVEAKVAALEKDAPRLRQADIQKRQQEINKLGAAEDAELQKLMQEQDKKVQEFQAQNEKRQAEERGKLLDSIQTATNNLAKAKGYTYVLDANSVVFAVEGKDITEEVLKSIPASEKAQEKK
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 1.2 mg/ml

Gene Information

• Official Symbol: omp26
• UniProt ID: Q57483