Recombinant HHV-2 Envelope glycoprotein B Protein, His-SUMO-tagged
| Cat.No. : | gB-1221H |
| Product Overview : | Recombinant HHV-2 Envelope glycoprotein B Protein, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HHV2 |
| Source : | E.coli |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 44.4 kDa |
| AA Sequence : | APAAPAAPRASGGVAATVAANGGPASRPPPVPSPATTKARKRKTKKPPKRPEATPPPDANATVAAGHATL RAHLREIKVENADAQFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMYYKD VTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINTKGVCRSTAKYVRNNMETTAFHRDDHETDMELKPA KVATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Envelope glycoprotein B |
| Official Symbol | Envelope glycoprotein B |
| Synonyms | Envelope glycoprotein B; UL27; gB |
| UniProt ID | P08666 |
| ◆ Recombinant Proteins | ||
| gB-1221H | Recombinant HHV-2 Envelope glycoprotein B Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Envelope glycoprotein B Products
Required fields are marked with *
My Review for All Envelope glycoprotein B Products
Required fields are marked with *
