Recombinant HPV B19 NS1 Protein, His-SUMO-tagged
| Cat.No. : | NS1-1301H |
| Product Overview : | Recombinant HPV B19 NS1 Protein (1-255aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | HPV B19 |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-255 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 44.6 kDa |
| AA Sequence : | MELFRGVLQVSSNVLDCANDNWWCSLLDLDTSDWEPLTHTNRLMAIYLSSVASKLDFTGGPLAGCLYFFQ VECNKFEEGYHIHVVTGGPGLNPRNLTVCVEGLFNNVLYHLVTENVKLKFLPGMTTKGKYFRDGEQFIEN YLMKKIPLNVVWCVTNIDGYIDTCISATFRRGACHAKKPRITTAINDTSSDAGESSGTGAEVVPFNGKGT KASIKFQTMVNWLCENRVFTEDKWKLVDFNQYTLLSSSHSGSFQI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Non-capsid protein NS-1 |
| Official Symbol | Non-capsid protein NS-1 |
| Synonyms | Non-capsid protein NS-1; NS1; NCVP1; Non-structural protein NS1 |
| UniProt ID | P07298 |
| ◆ Recombinant Proteins | ||
| NS1-1301H | Recombinant HPV B19 NS1 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Non-capsid protein NS-1 Products
Required fields are marked with *
My Review for All Non-capsid protein NS-1 Products
Required fields are marked with *
