Recombinant Human A2LD1, His-tagged

Cat.No. : A2LD1-26036TH
Product Overview : Recombinant full length Human A2LD1 with an N terminal His tag; 173 amino acids with a predicted MWt 19.4kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 153 amino acids
Description : The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
Conjugation : HIS
Molecular Weight : 19.400kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR
Sequence Similarities : Belongs to the gamma-glutamylcyclotransferase family.
Gene Name A2LD1 AIG2-like domain 1 [ Homo sapiens ]
Official Symbol A2LD1
Synonyms A2LD1; AIG2-like domain 1; gamma-glutamylaminecyclotransferase; gamma glutamylamine cyclotransferase; GGACT;
Gene ID 87769
mRNA Refseq NM_033110
Protein Refseq NP_149101
MIM 613378
Uniprot ID Q9BVM4
Chromosome Location 13q32.3
Function gamma-glutamylcyclotransferase activity; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All A2LD1 Products

Required fields are marked with *

My Review for All A2LD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon