Recombinant Human AADAC protein, GST-tagged
Cat.No. : | AADAC-3747H |
Product Overview : | Recombinant Human AADAC protein(24-96 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-96 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ] |
Official Symbol | AADAC |
Synonyms | AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC; |
Gene ID | 13 |
mRNA Refseq | NM_001086 |
Protein Refseq | NP_001077 |
MIM | 600338 |
UniProt ID | P22760 |
◆ Recombinant Proteins | ||
AADAC-170M | Recombinant Mouse AADAC Protein, His (Fc)-Avi-tagged | +Inquiry |
AADAC-2474H | Recombinant Human AADAC protein, His-tagged | +Inquiry |
AADAC-3747H | Recombinant Human AADAC protein, GST-tagged | +Inquiry |
AADAC-36R | Recombinant Rat AADAC Protein, His (Fc)-Avi-tagged | +Inquiry |
AADAC-9288HFL | Recombinant Full Length Human AADAC protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AADAC-9160HCL | Recombinant Human AADAC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AADAC Products
Required fields are marked with *
My Review for All AADAC Products
Required fields are marked with *
0
Inquiry Basket