Recombinant Human AADAC protein, His-tagged
| Cat.No. : | AADAC-2474H |
| Product Overview : | Recombinant Human AADAC protein(P22760)(24-399aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-399aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 49.1 kDa |
| AA Sequence : | PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | AADAC arylacetamide deacetylase (esterase) [ Homo sapiens ] |
| Official Symbol | AADAC |
| Synonyms | AADAC; arylacetamide deacetylase (esterase); arylacetamide deacetylase; CES5A1; DAC; |
| Gene ID | 13 |
| mRNA Refseq | NM_001086 |
| Protein Refseq | NP_001077 |
| MIM | 600338 |
| UniProt ID | P22760 |
| ◆ Recombinant Proteins | ||
| AADAC-36R | Recombinant Rat AADAC Protein, His (Fc)-Avi-tagged | +Inquiry |
| AADAC-3650H | Recombinant Human AADAC, His-tagged | +Inquiry |
| AADAC-2193H | Recombinant Human AADAC protein, His-tagged | +Inquiry |
| AADAC-9288HFL | Recombinant Full Length Human AADAC protein, Flag-tagged | +Inquiry |
| AADAC-745HF | Recombinant Full Length Human AADAC Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AADAC-9160HCL | Recombinant Human AADAC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AADAC Products
Required fields are marked with *
My Review for All AADAC Products
Required fields are marked with *
